PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 338aa    MW: 37687.9 Da    PI: 6.9685
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882520.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.73.3e-4051111262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+ 
  XP_015882520.1  51 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVV 111
                     6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2945105IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3352109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.18955109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGLTSLQVCM DSSDWLQGTM HEESGLDSSS PSGDMLTCSR PLIERRLRPP HDQALKCPRC  60
DSTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV VSKKPNDQSA  120
NSPSIINQNS IINNIPGSSS STTSNPTDLQ LSFPDQVHFS HLGNLLGPGL GNPASFMEAN  180
NKPIEFMESK LEAIVGNSRN YDFMGSGHGD HWNIGHQHHH QHHGLEQNNN FHGFCSPFGM  240
SMDANNGSFM DTCEKIMLPY DQAAADQHDK RLMLPYNQHH EDQNAVDVKP NTKLLSLDWQ  300
QDQGCSDAGK ESFGYLNGLT SWTNVMNNYG PSTTNPLV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2664221e-119KF266422.1 Ziziphus jujuba microsatellite SSR922 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882520.10.0PREDICTED: dof zinc finger protein DOF5.6
SwissprotQ9FM032e-53DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A061FV521e-156A0A061FV52_THECC; Dof-type zinc finger DNA-binding family protein isoform 1
STRINGVIT_17s0000g08290.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-51Dof family protein